Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 1
LigandBDBM50385850
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989568
IC50 0.501000±n/a nM
Citation Deng GZhao BMa YXu QWang HYang LZhang QGuo TBZhang WJiao YCai XZhang JLiu HGuan XLu HXiang JElliott JDLin XRen F Novel complex crystal structure of prolyl hydroxylase domain-containing protein 2 (PHD2): 2,8-Diazaspiro[4.5]decan-1-ones as potent, orally bioavailable PHD2 inhibitors. Bioorg Med Chem 21:6349-58 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 1
Name:Egl nine homolog 1
Synonyms:Egl nine homolog 1 (EGLIN1) | Egl nine homolog 1 (EGLN1) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIFPH2) | Prolyl hydroxylase domain-containing protein 2 (PHD2)
Type:Protein
Mol. Mass.:46035.59
Organism:Homo sapiens (Human)
Description:Q9GZT9
Residue:426
Sequence:
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385850
n/a
NameBDBM50385850
Synonyms:CHEMBL2042853
TypeSmall organic molecule
Emp. Form.C31H29N3O
Mol. Mass.459.5815
SMILESCc1cccnc1CN1CCC2(CC1)C(=O)N(c1ccccc21)c1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: