Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-sensitive inward rectifier potassium channel 1
LigandBDBM50442608
Substrate/Competitorn/a
Meas. Tech.ChEMBL_990656
IC50 38±n/a nM
Citation Tang Hde Jesus RKWalsh SPZhu YYan YPriest BTSwensen AMAlonso-Galicia MFelix JPBrochu RMBailey TThomas-Fowlkes BZhou XPai LYHampton CHernandez MOwens KRoy SKaczorowski GJYang LGarcia MLPasternak A Discovery of a novel sub-class of ROMK channel inhibitors typified by 5-(2-(4-(2-(4-(1H-Tetrazol-1-yl)phenyl)acetyl)piperazin-1-yl)ethyl)isobenzofuran-1(3H)-one. Bioorg Med Chem Lett 23:5829-32 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-sensitive inward rectifier potassium channel 1
Name:ATP-sensitive inward rectifier potassium channel 1
Synonyms:Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK)
Type:Enzyme Catalytic Domain
Mol. Mass.:44809.08
Organism:Homo sapiens (Human)
Description:gi_223460826
Residue:391
Sequence:
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442608
n/a
NameBDBM50442608
Synonyms:CHEMBL2441420
TypeSmall organic molecule
Emp. Form.C23H23FN6O3
Mol. Mass.450.4655
SMILESFc1c2COC(=O)c2ccc1CCN1CCN(CC1)C(=O)Cc1ccc(cc1)-n1cnnn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: