Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase NEK6
LigandBDBM50442758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989463
IC50>10.0±n/a nM
Citation Brasca MGMantegani SAmboldi NBindi SCaronni DCasale ECeccarelli WColombo NDe Ponti ADonati DErmoli AFachin GFelder ERFerguson RDFiorelli CGuanci MIsacchi APesenti EPolucci PRiceputi LSola FVisco CZuccotto FFogliatto G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem 21:7047-63 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase NEK6
Name:Serine/threonine-protein kinase NEK6
Synonyms:NEK6
Type:PROTEIN
Mol. Mass.:35724.53
Organism:Homo sapiens (Human)
Description:ChEMBL_1446777
Residue:313
Sequence:
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
QVAKQMHIWMSST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442758
n/a
NameBDBM50442758
Synonyms:CHEMBL2443139
TypeSmall organic molecule
Emp. Form.C25H30N4O5
Mol. Mass.466.5295
SMILESCC(C)Nc1ccc(Oc2cc(O)cc(O)c2-c2cc(no2)C(=O)NC2CCN(C)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: