Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase TTK
LigandBDBM50442758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989465
IC50>10.0±n/a nM
Citation Brasca MGMantegani SAmboldi NBindi SCaronni DCasale ECeccarelli WColombo NDe Ponti ADonati DErmoli AFachin GFelder ERFerguson RDFiorelli CGuanci MIsacchi APesenti EPolucci PRiceputi LSola FVisco CZuccotto FFogliatto G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem 21:7047-63 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase TTK
Name:Dual specificity protein kinase TTK
Synonyms:Dual specificity protein kinase (TTK) | Dual specificity protein kinase TTK (MPS1) | MPS1 | Monopolar Spindle 1 (MPS1) | Monopolar Spindle 1 (Mps-1) | Monopolar Spindle 1 Kinase (MPS1) | Phosphotyrosine picked threonine-protein kinase (MPS1) | TTK
Type:Protein
Mol. Mass.:97086.79
Organism:Homo sapiens (Human)
Description:P33981
Residue:857
Sequence:
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442758
n/a
NameBDBM50442758
Synonyms:CHEMBL2443139
TypeSmall organic molecule
Emp. Form.C25H30N4O5
Mol. Mass.466.5295
SMILESCC(C)Nc1ccc(Oc2cc(O)cc(O)c2-c2cc(no2)C(=O)NC2CCN(C)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: