Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 1
LigandBDBM50442759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989482
IC50>10.0±n/a nM
Citation Brasca MGMantegani SAmboldi NBindi SCaronni DCasale ECeccarelli WColombo NDe Ponti ADonati DErmoli AFachin GFelder ERFerguson RDFiorelli CGuanci MIsacchi APesenti EPolucci PRiceputi LSola FVisco CZuccotto FFogliatto G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem 21:7047-63 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 1
Name:Mitogen-activated protein kinase 1
Synonyms:ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | p42-MAPK
Type:Ser/Thr Protein Kinase
Mol. Mass.:41392.76
Organism:Homo sapiens (Human)
Description:P28482
Residue:360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442759
n/a
NameBDBM50442759
Synonyms:CHEMBL2443138
TypeSmall organic molecule
Emp. Form.C24H28N4O5
Mol. Mass.452.5029
SMILESCN(C)c1ccc(Oc2cc(O)cc(O)c2-c2cc(no2)C(=O)NC2CCN(C)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: