| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM50442758 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_989455 (CHEMBL2443982) |
|---|
| IC50 | >10.0±n/a nM |
|---|
| Citation |  Brasca, MG; Mantegani, S; Amboldi, N; Bindi, S; Caronni, D; Casale, E; Ceccarelli, W; Colombo, N; De Ponti, A; Donati, D; Ermoli, A; Fachin, G; Felder, ER; Ferguson, RD; Fiorelli, C; Guanci, M; Isacchi, A; Pesenti, E; Polucci, P; Riceputi, L; Sola, F; Visco, C; Zuccotto, F; Fogliatto, G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem21:7047-63 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM50442758 |
|---|
| n/a |
|---|
| Name | BDBM50442758 |
|---|
| Synonyms: | CHEMBL2443139 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N4O5 |
|---|
| Mol. Mass. | 466.5295 |
|---|
| SMILES | CC(C)Nc1ccc(Oc2cc(O)cc(O)c2-c2cc(no2)C(=O)NC2CCN(C)CC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
