Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRAC-alpha serine/threonine-protein kinase AKT1
LigandBDBM50442757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989493
IC50>10.0±n/a nM
Citation Brasca MGMantegani SAmboldi NBindi SCaronni DCasale ECeccarelli WColombo NDe Ponti ADonati DErmoli AFachin GFelder ERFerguson RDFiorelli CGuanci MIsacchi APesenti EPolucci PRiceputi LSola FVisco CZuccotto FFogliatto G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem 21:7047-63 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RAC-alpha serine/threonine-protein kinase AKT1
Name:RAC-alpha serine/threonine-protein kinase AKT1
Synonyms:AKT phosphorylation (p-AKT) | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT)
Type:Enzyme
Mol. Mass.:55681.25
Organism:Homo sapiens (Human)
Description:n/a
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442757
n/a
NameBDBM50442757
Synonyms:CHEMBL2443026
TypeSmall organic molecule
Emp. Form.C31H38N4O7
Mol. Mass.578.656
SMILESCN(C)c1ccc(Oc2cc(O)cc(O)c2-c2cc(no2)C(=O)NC2CCN(CC2)C2CCC3(CC2)OCCO3)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: