| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Ligand | BDBM50442997 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1276823 (CHEMBL3089491) |
|---|
| IC50 | 3.0±n/a nM |
|---|
| Citation |  Shirude, PS; Madhavapeddi, P; Naik, M; Murugan, K; Shinde, V; Nandishaiah, R; Bhat, J; Kumar, A; Hameed, S; Holdgate, G; Davies, G; McMiken, H; Hegde, N; Ambady, A; Venkatraman, J; Panda, M; Bandodkar, B; Sambandamurthy, VK; Read, JA Methyl-thiazoles: a novel mode of inhibition with the potential to develop novel inhibitors targeting InhA in Mycobacterium tuberculosis. J Med Chem56:8533-42 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28526.00 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | P9WGR1 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
|---|
| BDBM50442997 |
|---|
| n/a |
|---|
| Name | BDBM50442997 |
|---|
| Synonyms: | CHEMBL3088172 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16F2N6OS2 |
|---|
| Mol. Mass. | 434.486 |
|---|
| SMILES | Cc1csc(n1)[C@](C)(O)c1nnc(Nc2ccn(Cc3c(F)cccc3F)n2)s1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
