Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM81982 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1277048 (CHEMBL3088517) |
---|
Ki | 89±n/a nM |
---|
Citation | Torres-Gómez, H; Lehmkuhl, K; Schepmann, D; Wünsch, B Design, synthesis and receptor affinity of novel conformationally restricteds ligands based on the [4.3.3]propellane scaffold. Eur J Med Chem70:78-87 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM81982 |
---|
n/a |
---|
Name | BDBM81982 |
Synonyms: | CAS_97-39-2 | DITOLYLGUANIDINE | DTG | Di-o-tolylguanidine | Tol2Gdn | cid_7333 |
Type | Small organic molecule |
Emp. Form. | C15H17N3 |
Mol. Mass. | 239.3156 |
SMILES | Cc1ccccc1NC(N)=Nc1ccccc1C |w:10.11| |
Structure |
|