Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal Pro-X carboxypeptidase
LigandBDBM50443348
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1275524
IC50 0.280000±n/a nM
Citation Debenham JSGraham THVerras AZhang YClements MJKuethe JTMadsen-Duggan CLiu WBhatt URChen DChen QGarcia-Calvo MGeissler WMHe HLi XLisnock JShen ZTong XTung ECWiltsie JXu SHale JJPinto SShen DM Discovery and optimization of orally active cyclohexane-based prolylcarboxypeptidase (PrCP) inhibitors. Bioorg Med Chem Lett 23:6228-33 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal Pro-X carboxypeptidase
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:PROTEIN
Mol. Mass.:55028.96
Organism:Mus musculus
Description:ChEMBL_1335505
Residue:491
Sequence:
MGCRALLLLSFLLLGAATTIPPRLKTLGSPHLSASPTPDPAVARKYSVLYFEQKVDHFGF
ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGFMWDVAEELKAMLVFAEH
RYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTIPGAQGQPVIAIGGSYGG
MLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMKIVTNDFRKSGPYCSESIRKSWN
VIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIAETWVNLAMVNYPYACNFLQPLP
AWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQ
ACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHSNI
IFSNGELDPWSGGGVTRDITDTLVAINIHDGAHHLDLRAHNAFDPSSVLLSRLLEVKHMK
KWILDFYSNIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50443348
n/a
NameBDBM50443348
Synonyms:CHEMBL3086040 | US8669252, 12
TypeSmall organic molecule
Emp. Form.C29H30BrClFN3O2
Mol. Mass.586.923
SMILESFc1cc(ccn1)C(NC(=O)[C@@H]1CC[C@H](C[C@H]1c1ccc(Br)cc1)N1CCOCC1)c1ccc(Cl)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: