Reaction Details |
| Report a problem with these data |
Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Ligand | BDBM50443770 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1280332 (CHEMBL3095347) |
---|
Kd | 70000±n/a nM |
---|
Citation | Zhang, Z; Jakkaraju, S; Blain, J; Gogol, K; Zhao, L; Hartley, RC; Karlsson, CA; Staker, BL; Edwards, TE; Stewart, LJ; Myler, PJ; Clare, M; Begley, DW; Horn, JR; Hagen, TJ Cytidine derivatives as IspF inhibitors of Burkolderia pseudomallei. Bioorg Med Chem Lett23:6860-3 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
Synonyms: | ISPF_BURPS | MECDP-synthase | MECPP-synthase | MECPS | ispF | mecS |
Type: | PROTEIN |
Mol. Mass.: | 17174.90 |
Organism: | Burkholderia pseudomallei (strain K96243) |
Description: | ChEMBL_107981 |
Residue: | 162 |
Sequence: | MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIG
RHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAA
DLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVREAAA
|
|
|
BDBM50443770 |
---|
n/a |
---|
Name | BDBM50443770 |
Synonyms: | CHEMBL3094104 |
Type | Small organic molecule |
Emp. Form. | C15H16N6O5S |
Mol. Mass. | 392.39 |
SMILES | Nc1ccn([C@@H]2O[C@H](CNC(=O)c3cn4ccsc4n3)[C@@H](O)[C@H]2O)c(=O)n1 |r| |
Structure |
|