Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50443776
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1280374
Ki 13±n/a nM
Citation Wilson DMApps JBailey NBamford MJBeresford IJBriggs MACalver ARCrook BDavis RPDavis SDean DKHarris LHeightman TDPanchal TParr CAQuashie NSteadman JGSchogger JSehmi SSStean TOTakle AKTrail BKWhite TWitherington JWorby AMedhurst AD The discovery of the benzazepine class of histamine H3 receptor antagonists. Bioorg Med Chem Lett 23:6897-901 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50443776
n/a
NameBDBM50443776
Synonyms:CHEMBL3092836
TypeSmall organic molecule
Emp. Form.C24H35N3O3
Mol. Mass.413.553
SMILESO=C(N1CCOCC1)N1CCC(CC1)Oc1ccc2CCN(CCc2c1)C1CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: