Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Mer
LigandBDBM50444042
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1279519
IC50 1.7±n/a nM
Citation Zhang WZhang DStashko MADeRyckere DHunter DKireev DMiley MJCummings CLee MNorris-Drouin JStewart WMSather SZhou YKirkpatrick GMachius MJanzen WPEarp HSGraham DKFrye SVWang X Pseudo-cyclization through intramolecular hydrogen bond enables discovery of pyridine substituted pyrimidines as new Mer kinase inhibitors. J Med Chem 56:9683-92 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Mer
Name:Tyrosine-protein kinase Mer
Synonyms:MER | MER intracellular domain/EGFR extracellular domain chimera | MERTK | Proto-oncogene c-Mer | Proto-oncogene tyrosine-protein kinase MER | Receptor tyrosine kinase MerTK
Type:PROTEIN
Mol. Mass.:110234.77
Organism:Homo sapiens (Human)
Description:ChEMBL_1498723
Residue:999
Sequence:
MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQ
PALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVP
NIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKIN
NEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNE
QPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSI
LISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVS
CMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFI
PAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTE
EDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGS
VMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMS
SQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFL
HRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSK
SDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPD
SIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGE
RLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444042
n/a
NameBDBM50444042
Synonyms:CHEMBL3092807
TypeSmall organic molecule
Emp. Form.C24H36N6O2
Mol. Mass.440.5816
SMILESCCCCNc1ncc(c(N[C@H]2CC[C@H](O)CC2)n1)-c1ccc(CN2CCOCC2)cn1 |r,wU:11.10,wD:14.14,(58.28,-22.87,;59.62,-22.1,;60.95,-22.87,;62.28,-22.11,;63.62,-22.88,;64.95,-22.11,;66.29,-22.88,;67.62,-22.11,;67.62,-20.56,;66.28,-19.79,;66.28,-18.25,;64.94,-17.49,;63.62,-18.26,;62.28,-17.48,;62.28,-15.94,;60.94,-15.17,;63.61,-15.17,;64.94,-15.94,;64.95,-20.56,;68.95,-19.78,;70.28,-20.55,;71.61,-19.78,;71.6,-18.24,;72.93,-17.46,;74.27,-18.22,;74.27,-19.76,;75.6,-20.53,;76.93,-19.76,;76.93,-18.21,;75.59,-17.44,;70.26,-17.47,;68.93,-18.25,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: