Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoprotein lipase
LigandBDBM50444145
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1280894
IC50>10000±n/a nM
Citation Sun SDean RJia QZenova AZhong JGrayson CXie CLindgren ASamra PSojo Lvan Heek MLin LPercival DFu JMWinther MDZhang Z Discovery of XEN445: a potent and selective endothelial lipase inhibitor raises plasma HDL-cholesterol concentration in mice. Bioorg Med Chem 21:7724-34 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoprotein lipase
Name:Lipoprotein lipase
Synonyms:LPL
Type:PROTEIN
Mol. Mass.:53173.96
Organism:Homo sapiens (Human)
Description:ChEMBL_1280894
Residue:475
Sequence:
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444145
n/a
NameBDBM50444145
Synonyms:CHEMBL3093405
TypeSmall organic molecule
Emp. Form.C12H12F3NO2
Mol. Mass.259.2244
SMILESOC(=O)c1cc(ccc1NCC1CC1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: