Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgesterone receptor
LigandBDBM50444204
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1277676
IC50 5000±n/a nM
Citation Kuzmich DBentzien JBetageri RDiSalvo DFadra-Khan THarcken CKukulka ANabozny GNelson RPack ESouza DThomson D Function-regulating pharmacophores in a sulfonamide class of glucocorticoid receptor agonists. Bioorg Med Chem Lett 23:6640-4 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Progesterone receptor
Name:Progesterone receptor
Synonyms:Nuclear receptor subfamily 3 group C member 3 | PR | progesterone
Type:Protein
Mol. Mass.:98979.52
Organism:Homo sapiens (Human)
Description:P06401
Residue:933
Sequence:
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444204
n/a
NameBDBM50444204
Synonyms:CHEMBL3093462
TypeSmall organic molecule
Emp. Form.C19H21Cl2N3O2S
Mol. Mass.426.36
SMILESCC[C@@H](Cn1cc(C)c2ccccc12)NS(=O)(=O)c1c(N)cc(Cl)cc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: