Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein-1 (KLK1)
LigandBDBM50084637
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1278120
IC50>2000±n/a nM
Citation Lucas SDGonçalves LMCarvalho LACorreia HFDa Costa EMGuedes RAMoreira RGuedes RC Optimization of O3-acyl kojic acid derivatives as potent and selective human neutrophil elastase inhibitors. J Med Chem 56:9802-6 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein-1 (KLK1)
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084637
n/a
NameBDBM50084637
Synonyms:2,2-Dimethyl-propionic acid 4-[2-(carboxymethyl-carbamoyl)-phenylsulfamoyl]-phenyl ester | 2,2-Dimethyl-propionic acid 4-[2-(carboxymethyl-carbamoyl)-phenylsulfamoyl]-phenyl ester(ONO-5046) | CHEMBL76688 | ONO-5046 | Sivelestat
TypeSmall organic molecule
Emp. Form.C20H22N2O7S
Mol. Mass.434.463
SMILESCC(C)(C)C(=O)Oc1ccc(cc1)S(=O)(=O)Nc1ccccc1C(=O)NCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: