Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHexokinase type IV
LigandBDBM50444410
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1279808
EC50 26000±n/a nM
Citation Stevens BDLitchfield JPfefferkorn JAAtkinson KPerreault CAmor PBahnck KBerliner MACalloway JCarlo ADerksen DRFilipski KJGumkowski MJassal CMacDougall MMurphy BNkansah PPettersen JRotter CZhang Y Discovery of an intravenous hepatoselective glucokinase activator for the treatment of inpatient hyperglycemia. Bioorg Med Chem Lett 23:6588-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hexokinase type IV
Name:Hexokinase type IV
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:52101.81
Organism:Rattus norvegicus
Description:ChEMBL_1279785
Residue:465
Sequence:
MLDDRARMEATKKEKVEQILAEFQLQEEDLKKVMSRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDLDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSANPGQQLYEKIIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIHNILSTLGLRPS
VTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444410
n/a
NameBDBM50444410
Synonyms:CHEMBL3091580
TypeSmall organic molecule
Emp. Form.C20H24N4O5S
Mol. Mass.432.493
SMILESOC(=O)c1ccc(NC(=O)[C@H](CC2CCCC2)n2cnc(c2)S(=O)(=O)C2CC2)nc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: