Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM50444496
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1277729
Ki>3162±n/a nM
Citation Wilson DMApps JBailey NBamford MJBeresford IJBrackenborough KBriggs MABrough SCalver ARCrook BDavis RKDavis RPDavis SDean DKHarris LHeslop THolland VJeffrey PPanchal TAParr CAQuashie NSchogger JSehmi SSStean TOSteadman JGTrail BWald JWorby ATakle AKWitherington JMedhurst AD Identification of clinical candidates from the benzazepine class of histamine H3 receptor antagonists. Bioorg Med Chem Lett 23:6890-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444496
n/a
NameBDBM50444496
Synonyms:CHEMBL3092650
TypeSmall organic molecule
Emp. Form.C23H27N3O2
Mol. Mass.377.4794
SMILESO=C1CCCN1c1ccc(Oc2ccc3CCN(CCc3c2)C2CCC2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: