Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50083351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1281788
Ki 1.0±n/a nM
Citation Gitto RDe Luca LFerro SScala ARonsisvalle SParenti CPrezzavento OBuemi MRChimirri A From NMDA receptor antagonists to discovery of selectives2 receptor ligands. Bioorg Med Chem 22:393-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma-1 receptor
Synonyms:OPRS1 | SIGMAR1 | Sigma 1-type opioid receptor | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein
Type:Protein
Mol. Mass.:25307.17
Organism:Cavia porcellus (Guinea pig)
Description:Q60492
Residue:223
Sequence:
MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50083351
n/a
NameBDBM50083351
Synonyms:(+/-)-[2-(4-benzylpiperidino)-1-(4-hydroxyphenyl)-1-propanol] | -(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol | 4-(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol | 4-[2-(4-Benzyl-piperidin-1-yl)-1-hydroxy-propyl]-phenol | CHEMBL305187 | ChEMBL_104385 | IFENPRODIL
TypeSmall organic molecule
Emp. Form.C21H27NO2
Mol. Mass.325.4446
SMILESCC(C(O)c1ccc(O)cc1)N1CCC(Cc2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: