Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMandelate racemase (MR)
LigandBDBM81768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1282684
Ki 700000±n/a nM
Citation Harty MNagar MAtkinson LLegay CMDerksen DJBearne SL Inhibition of serine and proline racemases by substrate-product analogues. Bioorg Med Chem Lett 24:390-3 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mandelate racemase (MR)
Name:Mandelate racemase
Synonyms:Mandelate racemase
Type:Protein
Mol. Mass.:38561.77
Organism:Pseudomonas putida (g-Proteobacteria)
Description:n/a
Residue:359
Sequence:
MSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALK
SLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHE
TPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVR
SIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLN
VPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQ
EISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81768
n/a
NameBDBM81768
Synonyms:BENZYLIC ACID | CAS_6581-06-2 | NSC_5311391 | Quinuclidinyl benzilate
TypeSmall organic molecule
Emp. Form.C14H12O3
Mol. Mass.228.2433
SMILESOC(=O)C(O)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: