Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransporter
LigandBDBM50124566
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1282844
Ki 0.690000±n/a nM
Citation Sharma HSantra SDebnath JAntonio TReith MDutta A Flexible and biomimetic analogs of triple uptake inhibitor 4-((((3S,6S)-6-benzhydryltetrahydro-2H-pyran-3-yl)amino)methyl)phenol: Synthesis, biological characterization, and development of a pharmacophore model. Bioorg Med Chem 22:311-24 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transporter
Name:Transporter
Synonyms:NET | Norepinephrine transporter(NET)
Type:Multi-pass membrane protein
Mol. Mass.:69236.90
Organism:Rattus norvegicus (rat)
Description:Q63380
Residue:617
Sequence:
MLLARMKPQVQPELGGADQLPEQPLRPCKTADLLVVKERNGVQCLLASQDGDAQPRETWG
KEIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQFN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHAW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124566
n/a
NameBDBM50124566
Synonyms:(R)-2-((R)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine | (S)-2-((S)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine | 2-((2-ethoxyphenoxy)(phenyl)methyl)morpholine | 2-[(2-Ethoxy-phenoxy)-phenyl-methyl]-morpholine | 2-[2-ethoxyphenoxy(phenyl)methyl]-1,4-oxazinane | CHEMBL14370 | REBOXETINE | rac-syn-2-((2-ethoxyphenoxy)(phenyl)methyl)morpholine
TypeSmall organic molecule
Emp. Form.C19H23NO3
Mol. Mass.313.3908
SMILESCCOc1ccccc1OC(C1CNCCO1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: