Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
LigandBDBM50444981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1281519
Ki 0.220000±n/a nM
Citation Kim JJWood MRStachel SJde Leon PNomland AStump CAMcWherter MASchirripa KMMoore ELSalvatore CASelnick HG (E)-Alkenes as replacements of amide bonds: development of novel and potent acyclic CGRP receptor antagonists. Bioorg Med Chem Lett 24:258-61 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Name:Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Synonyms:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 327200
Components:This complex has 2 components.
Component 1
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:16992.80
Organism:Homo sapiens (Human)
Description:EBI_100673
Residue:148
Sequence:
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444981
n/a
NameBDBM50444981
Synonyms:CHEMBL3099919
TypeSmall organic molecule
Emp. Form.C30H32N4O2
Mol. Mass.480.6007
SMILESC[C@@H](N(C\C=C\c1cnc2C[C@]3(Cc2c1)C(=O)Nc1ncccc31)C(=O)C(C)(C)C)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: