Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM106803
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1284449
Ki 0.001000±n/a nM
Citation Burger MTHan WLan JNishiguchi GBellamacina CLindval MAtallah GDing YMathur MMcBride CBeans ELMuller KTamez VZhang YHuh KFeucht PZavorotinskaya TDai YHolash JCastillo JLangowski JWang YChen MYGarcia PD Structure Guided Optimization, in Vitro Activity, and in Vivo Activity of Pan-PIM Kinase Inhibitors. ACS Med Chem Lett 4:1193-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase pim-1
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM106803
n/a
NameBDBM106803
Synonyms:US8592455, 3
TypeSmall organic molecule
Emp. Form.C23H23F3N6O2
Mol. Mass.472.4629
SMILESC[C@H]1CN(C[C@@H](N)[C@@H]1O)c1ccncc1NC(=O)c1nc(c(F)cc1N)-c1c(F)cccc1F |r,wU:7.8,wD:1.0,5.5,(-6,2.69,;-4.67,1.93,;-4.67,.38,;-3.33,-.38,;-2,.38,;-2,1.93,;-.67,2.69,;-3.33,2.69,;-3.33,4.23,;-3.33,-1.93,;-4.67,-2.69,;-4.67,-4.23,;-3.33,-5,;-2,-4.23,;-2,-2.69,;-.67,-1.93,;.67,-2.69,;.67,-4.23,;2,-1.93,;2,-.38,;3.33,.38,;4.67,-.38,;6,.38,;4.67,-1.93,;3.33,-2.69,;3.33,-4.23,;3.33,1.93,;2,2.69,;.67,1.93,;2,4.23,;3.33,5,;4.67,4.23,;4.67,2.69,;6,1.93,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: