Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-3
LigandBDBM50387298
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1284448
Ki 0.230000±n/a nM
Citation Burger MTHan WLan JNishiguchi GBellamacina CLindval MAtallah GDing YMathur MMcBride CBeans ELMuller KTamez VZhang YHuh KFeucht PZavorotinskaya TDai YHolash JCastillo JLangowski JWang YChen MYGarcia PD Structure Guided Optimization, in Vitro Activity, and in Vivo Activity of Pan-PIM Kinase Inhibitors. ACS Med Chem Lett 4:1193-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-3
Name:Serine/threonine-protein kinase pim-3
Synonyms:Serine/threonine-protein kinase pim-3 (PIM3)
Type:Protein
Mol. Mass.:35888.19
Organism:Homo sapiens (Human)
Description:Q86V86
Residue:326
Sequence:
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50387298
n/a
NameBDBM50387298
Synonyms:CHEMBL2048872
TypeSmall organic molecule
Emp. Form.C21H21N3O2S
Mol. Mass.379.475
SMILESN[C@@H]1CCCN(C1)c1c(C=C2SC(O)=NC2=O)cccc1-c1ccccc1 |r,w:9.9,c:14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: