Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y1
LigandBDBM50429537
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1284785
IC50 29±n/a nM
Citation Qiao JXWang TCRuel RThibeault CL'Heureux ASchumacher WASpronk SAHiebert SBouthillier GLloyd JPi ZSchnur DMAbell LMHua JPrice LALiu EWu QSteinbacher TEBostwick JSChang MZheng JGao QMa BMcDonnell PAHuang CSRehfuss RWexler RRLam PY Conformationally constrained ortho-anilino diaryl ureas: discovery of 1-(2-(1'-neopentylspiro[indoline-3,4'-piperidine]-1-yl)phenyl)-3-(4-(trifluoromethoxy)phenyl)urea, a potent, selective, and bioavailable P2Y1 antagonist. J Med Chem 56:9275-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y1
Name:Purinergic receptor P2Y1
Synonyms:ATP receptor | P2Y purinoceptor 1 (P2Y1) | P2Y1 | Purinergic receptor
Type:Enzyme
Mol. Mass.:42090.25
Organism:Homo sapiens (Human)
Description:P47900
Residue:373
Sequence:
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429537
n/a
NameBDBM50429537
Synonyms:CHEMBL2333770
TypeSmall organic molecule
Emp. Form.C23H22F3N3O3
Mol. Mass.445.4343
SMILESCC(C)(C)c1ccccc1Oc1ncccc1NC(=O)Nc1ccc(OC(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: