Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM7460 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1284297 (CHEMBL3108318) |
---|
IC50 | 500±n/a nM |
---|
Citation | El Amrani, M; Lai, D; Debbab, A; Aly, AH; Siems, K; Seidel, C; Schnekenburger, M; Gaigneaux, A; Diederich, M; Feger, D; Lin, W; Proksch, P Protein kinase and HDAC inhibitors from the endophytic fungus Epicoccum nigrum. J Nat Prod77:49-56 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM7460 |
---|
n/a |
---|
Name | BDBM7460 |
Synonyms: | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US11021454, Compound Quercetin | US9180183, Quercetin | med.21724, Compound 4 |
Type | Small organic molecule |
Emp. Form. | C15H10O7 |
Mol. Mass. | 302.2357 |
SMILES | Oc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O |
Structure |
|