BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phospho-1-fructokinase, putative
LigandBDBM50446109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1288119
IC50 6500±n/a nM
Citation Brimacombe KRWalsh MJLiu LVásquez-Valdivieso MGMorgan HPMcNae IFothergill-Gilmore LAMichels PAAuld DSSimeonov AWalkinshaw MDShen MBoxer MB Identification of ML251, a Potent Inhibitor of T. brucei and T. cruzi Phosphofructokinase. ACS Med Chem Lett 5:12-7 (2014) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
6-phospho-1-fructokinase, putative
Name:6-phospho-1-fructokinase, putative
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53606.14
Organism:Trypanosoma cruzi
Description:ChEMBL_108019
Residue:485
Sequence:
MENRLRDTSRVVRSHAAPLNEVTQEDLRVERLHGRKYMNPSKKHVMREEFSDKIEHIMHD
PRPQEGVHSELPVSISPLLCELAAPRQRIHFNPPETVVGIVTCGGICPGLNDVIRSLTLT
AVNAYRVKRVIGFRFGYWGLSKKGSHTAMELYRTSVTSIHRYGGTILGSSRGPQDPSEMV
DTLERLGVNILFTVGGDGTQRGALKIAEEAKRRGVNLAVFGIPKTIDNDLSFSHRTFGFE
TAVDKAVEAVRAAYAEAISLNYGVGVVKLMGRDSGFIAAEAAVASAQANICLVPENPISE
DIVMALIQRRFETSRSCVIIVAEGFGQDWEGGTGGHDASGNKKLTDIGVVLTKRIQAWLR
KNKERYPSGTVKYIDPSYMIRACPPSANDALFCATLSTLAMHEAMAGATNCIIALRYNSY
ILVPIKVATSVRRVLDLRGQLWRQVREITVGLQDDVRAFKEAEVRRELEAISLVRERLIG
QLSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446109
n/a
NameBDBM50446109
Synonyms:CHEMBL3108850
TypeSmall organic molecule
Emp. Form.C20H21N3O4S
Mol. Mass.399.463
SMILESCc1cc(NS(=O)(=O)c2ccc(NC(=O)Cc3ccc(C)c(C)c3)cc2)no1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: