Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phospho-1-fructokinase
LigandBDBM50336799
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1288121
IC50 3000±n/a nM
Citation Brimacombe KRWalsh MJLiu LVásquez-Valdivieso MGMorgan HPMcNae IFothergill-Gilmore LAMichels PAAuld DSSimeonov AWalkinshaw MDShen MBoxer MB Identification of ML251, a Potent Inhibitor of T. brucei and T. cruzi Phosphofructokinase. ACS Med Chem Lett 5:12-7 (2014) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
6-phospho-1-fructokinase
Name:6-phospho-1-fructokinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53537.94
Organism:Trypanosoma brucei
Description:ChEMBL_1288121
Residue:487
Sequence:
MAVESRSRVTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIM
YNPRPRDEPSSENPVSVSPLLCELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSIT
LTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSRGPQDPKE
MVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGVPKTIDNDLSFSHRTFG
FQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANICLVPENPI
SEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGSGGYDASGNKKLIDIGVILTEKVKAF
LKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHN
NYILVPIKVATSVRRVLDLRGQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRL
HEELAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336799
n/a
NameBDBM50336799
Synonyms:5,5',5''-[1,3,6-naphthalenetriyltris(sulfonylimino)]tris[1,3-benzenesulfonate analogue | 8,8'-(Carbonylbis(imino-3,1-phenylenecarbonylimino(4-methyl-3,1-phenylene)carbonylimino))bisnaphthalene-1,3,5-trisulphonic acid | 8,8'-[CARBONYLBIS[IMINO-3,1-PHENYLENECARBONYLIMINO(4-METHYL-3,1-PHENYLENE)CARBONYLIMINO]]BIS-1,3,5-NAPHTHALENETRISULFONIC ACID | 8,8'-[Carbonylbis[imino-3,1-phenylenecarbonylimino(4-methyl-3,1-phenylene)carbonyl-imino]]bis-1,3,5-naphthalenetrisulfonic acid(suramin) | 8-[(4-methyl-3-{[3-({[3-({2-methyl-5-[(4,6,8-trisulfonaphthalen-1-yl)carbamoyl]phenyl}carbamoyl)phenyl]carbamoyl}amino)benzene]amido}benzene)amido]naphthalene-1,3,5-trisulfonic acid | CHEMBL265502 | Germanin | Suramin hexasodium | US8835659, Suramin | Urea derivative | suramin
TypeSmall organic molecule
Emp. Form.C51H40N6O23S6
Mol. Mass.1297.28
SMILESCc1ccc(cc1NC(=O)c1cccc(NC(=O)Nc2cccc(c2)C(=O)Nc2cc(ccc2C)C(=O)Nc2ccc(c3cc(cc(c23)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O)c1)C(=O)Nc1ccc(c2cc(cc(c12)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: