Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phospho-1-fructokinase
LigandBDBM50446089
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1288121
IC50 112±n/a nM
Citation Brimacombe KRWalsh MJLiu LVásquez-Valdivieso MGMorgan HPMcNae IFothergill-Gilmore LAMichels PAAuld DSSimeonov AWalkinshaw MDShen MBoxer MB Identification of ML251, a Potent Inhibitor of T. brucei and T. cruzi Phosphofructokinase. ACS Med Chem Lett 5:12-7 (2014) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
6-phospho-1-fructokinase
Name:6-phospho-1-fructokinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53537.94
Organism:Trypanosoma brucei
Description:ChEMBL_1288121
Residue:487
Sequence:
MAVESRSRVTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIM
YNPRPRDEPSSENPVSVSPLLCELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSIT
LTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSRGPQDPKE
MVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGVPKTIDNDLSFSHRTFG
FQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANICLVPENPI
SEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGSGGYDASGNKKLIDIGVILTEKVKAF
LKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHN
NYILVPIKVATSVRRVLDLRGQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRL
HEELAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446089
n/a
NameBDBM50446089
Synonyms:CHEMBL3108869
TypeSmall organic molecule
Emp. Form.C16H12Cl2N4O3S2
Mol. Mass.443.327
SMILESClc1ccc(CC(=O)Nc2ccc(cc2)S(=O)(=O)Nc2nncs2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: