Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM50446456
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1287773
IC50>100000±n/a nM
Citation Naud SWestwood IMFaisal ASheldrake PBavetsias VAtrash BCheung KMLiu MHayes ASchmitt JWood AChoi VBoxall KMak GGurden MValenti Mde Haven Brandon AHenley ABaker RMcAndrew CMatijssen BBurke RHoelder SEccles SARaynaud FILinardopoulos Svan Montfort RLBlagg J Structure-based design of orally bioavailable 1H-pyrrolo[3,2-c]pyridine inhibitors of mitotic kinase monopolar spindle 1 (MPS1). J Med Chem 56:10045-65 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446456
n/a
NameBDBM50446456
Synonyms:CHEMBL3109965
TypeSmall organic molecule
Emp. Form.C19H16F3N5O
Mol. Mass.387.3584
SMILESCOc1ccc(cc1Nc1cc2[nH]c(cc2cn1)-c1cnn(C)c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: