| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcription factor Jun |
|---|
| Ligand | BDBM50133496 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1290685 (CHEMBL3117488) |
|---|
| IC50 | 16200±n/a nM |
|---|
| Citation |  Chen, YS; Yu, HM; Shie, JJ; Cheng, TJ; Wu, CY; Fang, JM; Wong, CH Chemical constituents of Plectranthus amboinicus and the synthetic analogs possessing anti-inflammatory activity. Bioorg Med Chem22:1766-72 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcription factor Jun |
|---|
| Name: | Transcription factor Jun |
|---|
| Synonyms: | AP1 | Activator protein 1 | JUN | JUN_HUMAN | Proto-oncogene c-JUN | Transcription factor AP-1 | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 35683.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05412 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
|
|
|
|---|
| BDBM50133496 |
|---|
| n/a |
|---|
| Name | BDBM50133496 |
|---|
| Synonyms: | (2R)-3-(3,4-dihydroxyphenyl)-2-[(2E)-3-(3,4-dihydroxyphenyl)prop-2-enoyloxy]propanoic acid | (R)-rosmarinic acid | CHEMBL324842 | Rosmarinic acid, 2 | US10688093, Compound rosmarinic acid | US11701353, rosmarinic acid | cid_5281792 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16O8 |
|---|
| Mol. Mass. | 360.3148 |
|---|
| SMILES | OC(=O)[C@@H](Cc1ccc(O)c(O)c1)OC(=O)\C=C\c1ccc(O)c(O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
