Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 1
LigandBDBM50446893
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290293
IC50 0.650000±n/a nM
Citation Rabinowitz MH Inhibition of hypoxia-inducible factor prolyl hydroxylase domain oxygen sensors: tricking the body into mounting orchestrated survival and repair responses. J Med Chem 56:9369-402 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 1
Name:Egl nine homolog 1
Synonyms:Egl nine homolog 1 (EGLIN1) | Egl nine homolog 1 (EGLN1) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIFPH2) | Prolyl hydroxylase domain-containing protein 2 (PHD2)
Type:Protein
Mol. Mass.:46035.59
Organism:Homo sapiens (Human)
Description:Q9GZT9
Residue:426
Sequence:
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446893
n/a
NameBDBM50446893
Synonyms:CHEMBL3115307
TypeSmall organic molecule
Emp. Form.C18H12ClF3N4O5
Mol. Mass.456.76
SMILESOC(=O)CNC(=O)c1c(O)c2cc(Cl)cnc2n(Cc2ccc(nc2)C(F)(F)F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: