Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA gyrase subunit B
LigandBDBM50447301
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1291282
IC50 5.0±n/a nM
Citation Kale RRKale MGWaterson DRaichurkar AHameed SPManjunatha MRKishore Reddy BKMalolanarasimhan KShinde VKoushik KJena LKMenasinakai SHumnabadkar VMadhavapeddi PBasavarajappa HSharma SNandishaiah RMahesh Kumar KNGanguly SAhuja VGaonkar SNaveen Kumar CNOgg DBoriack-Sjodin PASambandamurthy VKde Sousa SMGhorpade SR Thiazolopyridone ureas as DNA gyrase B inhibitors: optimization of antitubercular activity and efficacy. Bioorg Med Chem Lett 24:870-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA gyrase subunit B
Name:DNA gyrase subunit B
Synonyms:gyrB
Type:PROTEIN
Mol. Mass.:74505.25
Organism:Mycobacterium smegmatis
Description:ChEMBL_107961
Residue:675
Sequence:
MAAQKNNAPKEYGADSITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAG
FATRVDVKIHADGSVEVRDDGRGIPVEMHATGMPTIDVVMTQLHAGGKFDGETYAVSGGL
HGVGVSVVNALSTRLEATVLRDGYEWFQYYDRSVPGKLKQGGETKETGTTIRFWADPEIF
ETTDYNFETVARRLQEMAFLNKGLTIELTDERVTAEEVVDDVVKDTAEAPKTADEKAAEA
TGPSKVKHRVFHYPGGLVDYVKHINRTKTPIQQSIIDFDGKGPGHEVEIAMQWNAGYSES
VHTFANTINTHEGGTHEEGFRAALTSVVNRYAKDKKLLKDKDPNLTGDDIREGLAAVISV
KVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEANPAEAKTVVNKAVSSAQARIAA
RKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAILP
LRGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEFDISKLRYHKIVLMADADVDGQHI
STLLLTLLFRFMKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRERDGLLEAGRAAGKK
INVDDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVEARR
SFITRNAKDVRFLDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447301
n/a
NameBDBM50447301
Synonyms:CHEMBL3114206
TypeSmall organic molecule
Emp. Form.C20H25N5O3S
Mol. Mass.415.509
SMILESCCNC(=O)Nc1nc2cc(-c3cc(C)n(CC)c(=O)c3)c(=O)n(C(C)C)c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: