Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetprotein-arginine deiminase type-4
LigandBDBM50447757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290377
IC50 640±n/a nM
Citation Dreyton CJAnderson EDSubramanian VBoger DLThompson PR Insights into the mechanism of streptonigrin-induced protein arginine deiminase inactivation. Bioorg Med Chem 22:1362-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
protein-arginine deiminase type-4
Name:protein-arginine deiminase type-4
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:74078.90
Organism:Homo sapiens (Human)
Description:gi_216548487
Residue:663
Sequence:
MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKK
KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCAD
ITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDM
SLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV
PGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAP
HKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVP
APDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNS
FVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK
PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVRRKPFSFKWWN
MVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447757
n/a
NameBDBM50447757
Synonyms:CHEMBL57818
TypeSmall organic molecule
Emp. Form.C14H9N3O2
Mol. Mass.251.2402
SMILESNC1=CC(=O)c2ccc(nc2C1=O)-c1ccccn1 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: