Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine deiminase type-3
LigandBDBM50447761
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290378
IC50 170±n/a nM
Citation Dreyton CJAnderson EDSubramanian VBoger DLThompson PR Insights into the mechanism of streptonigrin-induced protein arginine deiminase inactivation. Bioorg Med Chem 22:1362-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine deiminase type-3
Name:Protein-arginine deiminase type-3
Synonyms:Peptidylarginine deiminase III | Protein-arginine deiminase type III
Type:PROTEIN
Mol. Mass.:74727.86
Organism:Homo sapiens (Human)
Description:ChEMBL_1290378
Residue:664
Sequence:
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGR
ERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLD
CDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDVQDNCDQHVHCLQDLEDM
SVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVP
RLHGDEERFFVEGLSFPDAGFTGLISFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQKVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINY
NKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTERKKATAFFPDLVNMLVLGKHLGIP
KPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVCRKPFSFKWW
NMVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447761
n/a
NameBDBM50447761
Synonyms:CHEMBL60908
TypeSmall organic molecule
Emp. Form.C9H6N2O2
Mol. Mass.174.1561
SMILESNC1=CC(=O)c2cccnc2C1=O |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: