Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine deiminase type-1
LigandBDBM50447759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290380
IC50 2270±n/a nM
Citation Dreyton CJAnderson EDSubramanian VBoger DLThompson PR Insights into the mechanism of streptonigrin-induced protein arginine deiminase inactivation. Bioorg Med Chem 22:1362-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine deiminase type-1
Name:Protein-arginine deiminase type-1
Synonyms:Peptidylarginine deiminase I | Protein-arginine deiminase type I
Type:PROTEIN
Mol. Mass.:74664.17
Organism:Homo sapiens (Human)
Description:ChEMBL_1290380
Residue:663
Sequence:
MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVK
EPIGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLE
VDTGRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDM
SPMLLSCNGPDKLFDSHKLVLNVPFSDSKRVRVFCARGGNSLSDYKQVLGPQCLSYEVER
QPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEVTLFTDTVGFRMAPWIMTPNT
QPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWIQDEMEFGYIE
APHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV
GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDN
LHAQKCIDWNRNVLKRELGLAESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPK
PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVRRKPFPFKWWN
MVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447759
n/a
NameBDBM50447759
Synonyms:CHEMBL3113470
TypeSmall organic molecule
Emp. Form.C9H5BrN2O2
Mol. Mass.253.052
SMILESNC1=C(Br)C(=O)c2cccnc2C1=O |c:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: