Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, muscarinic
LigandBDBM39342
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1292393
EC50 1413±n/a nM
Citation Matera CFlammini LQuadri MVivo VBallabeni VHolzgrabe UMohr KDe Amici MBarocelli EBertoni SDallanoce C Bis(ammonio)alkane-type agonists of muscarinic acetylcholine receptors: synthesis, in vitro functional characterization, and in vivo evaluation of their analgesic activity. Eur J Med Chem 75:222-32 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinergic, muscarinic
Name:Muscarinic acetylcholine receptor M2
Synonyms:GPM2 | LOC100715343 | Muscarinic acetylcholine receptor M2 | Muscarinic receptor 2
Type:Enzyme Catalytic Domain
Mol. Mass.:51688.65
Organism:GUINEA PIG
Description:Cholinergic, muscarinic 0 GUINEA PIG::P06199
Residue:466
Sequence:
MNNSTNSSNSGLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQEPVSPSLVQGRI
VKPNNNNMPGSDEALEHNKIQNGKAPRDAVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIKIVTKTQKSDSCTPANTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39342
n/a
NameBDBM39342
Synonyms:2-aminocarbonyloxypropyl(trimethyl)azanium;chloride | 2-carbamoyloxypropyl(trimethyl)ammonium;chloride | 2-carbamoyloxypropyl(trimethyl)azanium;chloride | BETHANECHOL | BETHANECHOL CHLORIDE | Bethanecol | Hermes, Myo | MLS000028675 | Myotonine | SMR000058680 | cid_11548
TypeSmall organic molecule
Emp. Form.C7H17N2O2
Mol. Mass.161.2215
SMILESCC(C[N+](C)(C)C)OC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: