Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA (cytosine-5)-methyltransferase 3-like
LigandBDBM50448489
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1294383
IC50 27000±n/a nM
Citation Valente SLiu YSchnekenburger MZwergel CCosconati SGros CTardugno MLabella DFlorean CMinden SHashimoto HChang YZhang XKirsch GNovellino EArimondo PBMiele EFerretti EGulino ADiederich MCheng XMai A Selective non-nucleoside inhibitors of human DNA methyltransferases active in cancer including in cancer stem cells. J Med Chem 57:701-13 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA (cytosine-5)-methyltransferase 3-like
Name:DNA (cytosine-5)-methyltransferase 3-like
Synonyms:DNMT3L
Type:PROTEIN
Mol. Mass.:43578.37
Organism:Homo sapiens (Human)
Description:ChEMBL_108147
Residue:386
Sequence:
MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQ
VHTQHPLFEGGICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFE
CVDSLVGPGTSGKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFE
TVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDL
VYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASR
FLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQSSKLAAKWP
TKLVKNCFLPLREYFKYFSTELTSSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50448489
n/a
NameBDBM50448489
Synonyms:CHEMBL3126651
TypeSmall organic molecule
Emp. Form.C31H23N5O
Mol. Mass.481.5472
SMILESO=C(Nc1ccc(Nc2ccnc3ccccc23)cc1)c1ccc(Nc2ccnc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: