| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18069 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1298221 (CHEMBL3130226) |
|---|
| Ki | 1.2±n/a nM |
|---|
| Citation |  Lam, T; Hilgers, MT; Cunningham, ML; Kwan, BP; Nelson, KJ; Brown-Driver, V; Ong, V; Trzoss, M; Hough, G; Shaw, KJ; Finn, J Structure-based design of new dihydrofolate reductase antibacterial agents: 7-(benzimidazol-1-yl)-2,4-diaminoquinazolines. J Med Chem57:651-68 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18249.71 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM18069 |
|---|
| n/a |
|---|
| Name | BDBM18069 |
|---|
| Synonyms: | 5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine | CHEMBL22 | TMP | Trimethoprim | Trimethoprim (TMP) | US10870625, Compound TMP |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H18N4O3 |
|---|
| Mol. Mass. | 290.3177 |
|---|
| SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
