| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Ligand | BDBM50448858 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1296166 (CHEMBL3132000) |
|---|
| IC50 | 440±n/a nM |
|---|
| Citation |  Encinas, L; O'Keefe, H; Neu, M; Remuiñán, MJ; Patel, AM; Guardia, A; Davie, CP; Pérez-Macías, N; Yang, H; Convery, MA; Messer, JA; Pérez-Herrán, E; Centrella, PA; Alvarez-Gómez, D; Clark, MA; Huss, S; O'Donovan, GK; Ortega-Muro, F; McDowell, W; Castañeda, P; Arico-Muendel, CC; Pajk, S; Rullás, J; Angulo-Barturen, I; Alvarez-Ruíz, E; Mendoza-Losana, A; Ballell Pages, L; Castro-Pichel, J; Evindar, G Encoded library technology as a source of hits for the discovery and lead optimization of a potent and selective class of bactericidal direct inhibitors of Mycobacterium tuberculosis InhA. J Med Chem57:1276-88 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28526.00 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | P9WGR1 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
|---|
| BDBM50448858 |
|---|
| n/a |
|---|
| Name | BDBM50448858 |
|---|
| Synonyms: | CHEMBL3125278 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29N5O3 |
|---|
| Mol. Mass. | 423.5081 |
|---|
| SMILES | CCNC[C@@H]1C[C@H](CN1C(=O)c1coc2ccccc12)NC(=O)c1cc(CC)nn1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
