Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor
LigandBDBM50418562
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154529
Ki 51±n/a nM
Citation Henke BRBlanchard SGBrackeen MFBrown KKCobb JECollins JLHarrington WWHashim MAHull-Ryde EAKaldor IKliewer SALake DHLeesnitzer LMLehmann JMLenhard JMOrband-Miller LAMiller JFMook RANoble SAOliver WParks DJPlunket KDSzewczyk JRWillson TM N-(2-Benzoylphenyl)-L-tyrosine PPARgamma agonists. 1. Discovery of a novel series of potent antihyperglycemic and antihyperlipidemic agents. J Med Chem 41:5020-36 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor
Name:Peroxisome proliferator-activated receptor
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma | Peroxisome proliferator-activated receptor gamma (PPAR gamma) | Peroxisome proliferator-activated receptor gamma (PPARγ) | Peroxisome proliferator-activated receptor gamma (PPARG) | Peroxisome proliferator-activated receptor gamma/Nuclear receptor corepressor 2 | peroxisome proliferator-activated receptor gamma isoform 2
Type:Nuclear Receptor
Mol. Mass.:57613.46
Organism:Homo sapiens (Human)
Description:n/a
Residue:505
Sequence:
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50418562
n/a
NameBDBM50418562
Synonyms:CHEMBL357479
TypeSmall organic molecule
Emp. Form.C30H33NO4
Mol. Mass.471.5873
SMILESCC1(COc2ccc(C[C@H](Nc3ccccc3C(=O)c3ccccc3)C(O)=O)cc2)CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: