Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase BRK
LigandBDBM50001736
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1337320
IC50 41±n/a nM
Citation Mahmoud KAKrug MWersig TSlynko ISchächtele CTotzke FSippl WHilgeroth A Discovery of 4-anilinoa-carbolines as novel Brk inhibitors. Bioorg Med Chem Lett 24:1948-51 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase BRK
Name:Tyrosine-protein kinase BRK
Synonyms:Breast tumor kinase | KH domain-containing, RNA-binding, signal transduction-associated protein 1 | Protein-tyrosine kinase 6 (BRK) | Tyrosine Kinase BRK | Tyrosine-protein kinase 6
Type:Tyrosine-protein kinase
Mol. Mass.:51839.11
Organism:Homo sapiens (Human)
Description:n/a
Residue:451
Sequence:
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001736
n/a
NameBDBM50001736
Synonyms:CHEMBL3238096
TypeSmall organic molecule
Emp. Form.C24H19N3O
Mol. Mass.365.4272
SMILESC(Oc1cccc(Nc2ccnc3[nH]c4ccccc4c23)c1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: