Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHSP90 and hnRNPA2/B1
LigandBDBM50003890
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1336949
Ki 29±n/a nM
Citation Ernst JTNeubert TLiu MSperry SZuccola HTurnbull AFleck BKargo WWoody LChiang PTran DChen WSnyder PAlcacio TNezami AReynolds JAlvi KGoulet LStamos D Identification of novel HSP90a/ isoform selective inhibitors using structure-based drug design. demonstration of potential utility in treating CNS disorders such as Huntington's disease. J Med Chem 57:3382-400 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HSP90 and hnRNPA2/B1
Name:HSP90 and hnRNPA2/B1
Synonyms:HSP 84 | HSP 90 | Heat Shock Protein 90 (Hsp90) | Heat shock protein HSP 90 (Hsp90) | Heat shock protein HSP 90-beta
Type:Molecular Chaperone
Mol. Mass.:83229.45
Organism:Homo sapiens (Human)
Description:n/a
Residue:724
Sequence:
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003890
n/a
NameBDBM50003890
Synonyms:CHEMBL3235341
TypeSmall organic molecule
Emp. Form.C23H28F2N4O2
Mol. Mass.430.4908
SMILESCN1CCc2c(C1)n(c1CC(C)(C)CC(=O)c21)-c1ccc(C(N)=O)c(NCC(F)F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: