Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 3
LigandBDBM50005732
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1335253
IC50>100000±n/a nM
Citation Cincinelli RMusso LGiannini GZuco VDe Cesare MZunino FDallavalle S Influence of the adamantyl moiety on the activity of biphenylacrylohydroxamic acid-based HDAC inhibitors. Eur J Med Chem 79:251-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 3
Name:Histone deacetylase 1/2/3
Synonyms:HD3 | Histone deacetylase 3 (HDAC3) | Human HDAC3 | RPD3-2 | SMAP45
Type:Enzyme
Mol. Mass.:48829.55
Organism:Homo sapiens (Human)
Description:n/a
Residue:428
Sequence:
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005732
n/a
NameBDBM50005732
Synonyms:CHEMBL3235787
TypeSmall organic molecule
Emp. Form.C28H31NO3
Mol. Mass.429.5506
SMILESCOc1ccc(cc1C12CC3CC(CC(C3)C1)C2)-c1ccc(\C=C\C=C\C(=O)NO)cc1 |TLB:11:12:10.9.15:16,THB:11:10:12.17.13:16,13:12:9:15.14.16,13:14:11.12.17:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: