Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50137618
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1334696
Ki 627±n/a nM
Citation Mach RHZeng CHawkins WG Thes2 receptor: a novel protein for the imaging and treatment of cancer. J Med Chem 56:7137-60 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137618
n/a
NameBDBM50137618
Synonyms:5-Bromo-N-[4-(6,7-dimethoxy-3,4-dihydro-1H-isoquinolin-2-yl)-butyl]-2,3-dimethoxy-benzamide | 5-bromo-N-(4-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)butyl)-2,3-dimethoxybenzamide | CHEMBL291439
TypeSmall organic molecule
Emp. Form.C24H31BrN2O5
Mol. Mass.507.417
SMILESCOc1cc2CCN(CCCCNC(=O)c3cc(Br)cc(OC)c3OC)Cc2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: