| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50006607 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1334688 (CHEMBL3238571) |
|---|
| Ki | 27±n/a nM |
|---|
| Citation |  Mach, RH; Zeng, C; Hawkins, WG Thes2 receptor: a novel protein for the imaging and treatment of cancer. J Med Chem56:7137-60 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50006607 |
|---|
| n/a |
|---|
| Name | BDBM50006607 |
|---|
| Synonyms: | CHEMBL3235465 | US9604926, Compound SN-79 | US9724435, SN-79 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26FN3O3 |
|---|
| Mol. Mass. | 411.4692 |
|---|
| SMILES | CC(=O)c1ccc2n(CCCCN3CCN(CC3)c3ccc(F)cc3)c(=O)oc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
