Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 7 (CBX7)
LigandBDBM50009468
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1336411
IC50 6000±n/a nM
Citation Simhadri CDaze KDDouglas SFQuon TTDev AGignac MCPeng FHeller MBoulanger MJWulff JEHof F Chromodomain antagonists that target the polycomb-group methyllysine reader protein chromobox homolog 7 (CBX7). J Med Chem 57:2874-83 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chromobox protein homolog 7 (CBX7)
Name:Chromobox protein homolog 7
Synonyms:CBX7 | Chromobox protein homolog 7
Type:Protein
Mol. Mass.:28351.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:251
Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009468
n/a
NameBDBM50009468
Synonyms:CHEMBL3234150
TypeSmall organic molecule
Emp. Form.C33H54N7O7
Mol. Mass.660.824
SMILESC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)N[C@@H](C1CCCC1)C(=O)N[C@@H](CCCC[N+](C)(C)C)C(=O)N[C@@H](CO)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: