Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 7 (CBX7)
LigandBDBM50009482
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1336411
IC50 35000±n/a nM
Citation Simhadri CDaze KDDouglas SFQuon TTDev AGignac MCPeng FHeller MBoulanger MJWulff JEHof F Chromodomain antagonists that target the polycomb-group methyllysine reader protein chromobox homolog 7 (CBX7). J Med Chem 57:2874-83 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chromobox protein homolog 7 (CBX7)
Name:Chromobox protein homolog 7
Synonyms:CBX7 | Chromobox protein homolog 7
Type:Protein
Mol. Mass.:28351.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:251
Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009482
n/a
NameBDBM50009482
Synonyms:CHEMBL3234164
TypeSmall organic molecule
Emp. Form.C36H53N8O5
Mol. Mass.677.8561
SMILESCC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)N[C@@H](CCCC[N+](C)(C)C)C(=O)Nc1nc2ccccc2[nH]1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: