Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1
LigandBDBM50028166
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1345884
Ki 580±n/a nM
Citation Napoli JLCounsell RE New inhibitors of steroid 11beta-hydroxylase. Structure--activity relationship studies of metyrapone-like compounds. J Med Chem 20:762-6 (1977) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1
Name:Cytochrome P450 11B1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:57863.81
Organism:Bos taurus
Description:ChEMBL_1345884
Residue:503
Sequence:
MALWAKARVRMAGPWLSLHEARLLGTRGAAAPKAVLPFEAMPRCPGNKWMRMLQIWKEQS
SENMHLDMHQTFQELGPIFRYDVGGRHMVFVMLPEDVERLQQADSHHPQRMILEPWLAYR
QARGHKCGVFLLNGPQWRLDRLRLNPDVLSLPALQKYTPLVDGVARDFSQTLKARVLQNA
RGSLTLDIAPSVFRYTIEASTLVLYGERLGLLTQQPNPDSLNFIHALEAMLKSTVQLMFV
PRRLSRWMSTNMWREHFEAWDYIFQYANRAIQRIYQELALGHPWHYSGIVAELLMRADMT
LDTIKANTIDLTAGSVDTTAFPLLMTLFELARNPEVQQAVRQESLVAEARISENPQRAIT
ELPLLRAALKETLRLYPVGITLEREVSSDLVLQNYHIPAGTLVKVLLYSLGRNPAVFARP
ESYHPQRWLDRQGSGSRFPHLAFGFGVRQCLGRRVAEVEMLLLLHHVLKNFLVETLEQED
IKMVYRFILMPSTLPLFTFRAIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028166
n/a
NameBDBM50028166
Synonyms:CHEMBL934 | METYRAPONE | US9138393, Metyrapone | US9144538, Metyrapone | US9394290, MTP (metyrapone)
TypeSmall organic molecule
Emp. Form.C14H14N2O
Mol. Mass.226.2738
SMILESCC(C)(C(=O)c1cccnc1)c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: