Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50010230 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1341015 (CHEMBL3254994) |
---|
IC50 | 600±n/a nM |
---|
Citation | Martinelli, JE; Chaykovsky, M; Kisliuk, RL; Gaumont, Y; Gittelman, MC Methotrexate analogues. 12. Synthesis and biological properties of some aza homologues. J Med Chem22:869-74 (1979) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50010230 |
---|
n/a |
---|
Name | BDBM50010230 |
Synonyms: | CHEMBL3245586 |
Type | Small organic molecule |
Emp. Form. | C21H25N9O5 |
Mol. Mass. | 483.4805 |
SMILES | COC(=O)C[C@H](NC(=O)Nc1ccc(cc1)N(C)Cc1cnc2nc(N)nc(N)c2n1)C(=O)OC |r| |
Structure |
|